Desmin anticorps (N-Term)

N° du produit ABIN629811

Détail du produit anti-Desmin anticorps

Antigène: Desmin (DES)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Desmin est non-conjugé

Application: Western Blotting (WB)

Specificité: Desmin antibody was raised against the N terminal of DES

Purification: Purified

Immunogène: Desmin antibody was raised using the N terminal of DES corresponding to a region with amino acids PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Desmin Blocking Peptide, catalog no. 33R-7209, is also available for use as a blocking control in assays to test for specificity of this Desmin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DES antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Desmin

Antigène: Desmin (DES)

Autre désignation: Desmin (DES Produits)

Synonymes: anticorps DES, anticorps des-b, anticorps MGC80853, anticorps des, anticorps csm1, anticorps csm2, anticorps desm, anticorps cmd1i, anticorps MGC75911, anticorps LOC100220724, anticorps desmin, anticorps cb290, anticorps fb59a12, anticorps wu:fb59a12, anticorps zgc:109859, anticorps CSM1, anticorps CSM2, anticorps LGMD2R, anticorps wu:fc11d08, anticorps zgc:154009, anticorps des-a, anticorps MGC52614, anticorps desmin, anticorps desmin, gene 1 L homeolog, anticorps desmin, gene 1, anticorps desmin a, anticorps desmin b, anticorps desmin, gene 1 S homeolog, anticorps desmin, gene 2 S homeolog, anticorps DES, anticorps des.1.L, anticorps des.1, anticorps des, anticorps desma, anticorps Des, anticorps desmb, anticorps des.1.S, anticorps des.2.S

Sujet: DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.

Poids moléculaire: 52 kDa (MW of target protein)