Desmin anticorps (N-Term)
-
- Antigène Voir toutes Desmin (DES) Anticorps
- Desmin (DES)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Desmin est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Desmin antibody was raised against the N terminal of DES
- Purification
- Purified
- Immunogène
- Desmin antibody was raised using the N terminal of DES corresponding to a region with amino acids PLSSPVFPRAGFGSKGSSSSVTSRVYQVSRTSGGAGGLGSLRASRLGTTR
- Top Product
- Discover our top product DES Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Desmin Blocking Peptide, catalog no. 33R-7209, is also available for use as a blocking control in assays to test for specificity of this Desmin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DES antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Desmin (DES)
- Autre désignation
- Desmin (DES Produits)
- Synonymes
- anticorps DES, anticorps des-b, anticorps MGC80853, anticorps des, anticorps csm1, anticorps csm2, anticorps desm, anticorps cmd1i, anticorps MGC75911, anticorps LOC100220724, anticorps desmin, anticorps cb290, anticorps fb59a12, anticorps wu:fb59a12, anticorps zgc:109859, anticorps CSM1, anticorps CSM2, anticorps LGMD2R, anticorps wu:fc11d08, anticorps zgc:154009, anticorps des-a, anticorps MGC52614, anticorps desmin, anticorps desmin, gene 1 L homeolog, anticorps desmin, gene 1, anticorps desmin a, anticorps desmin b, anticorps desmin, gene 1 S homeolog, anticorps desmin, gene 2 S homeolog, anticorps DES, anticorps des.1.L, anticorps des.1, anticorps des, anticorps desma, anticorps Des, anticorps desmb, anticorps des.1.S, anticorps des.2.S
- Sujet
- DES is a muscle-specific class III intermediate filament. Homopolymers of this protein form a stable intracytoplasmic filamentous network connecting myofibrils to each other and to the plasma membrane. Mutations in its gene are associated with desmin-related myopathy, a familial cardiac and skeletal myopathy (CSM), and with distal myopathies.
- Poids moléculaire
- 52 kDa (MW of target protein)
-