PRMT1 anticorps (Middle Region)

N° du produit ABIN629816

L’anticorps Lapin Polyclonal anti-PRMT1 a été validé pour WB et IHC. Il convient pour détecter PRMT1 dans des échantillons de Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour PRMT1 anticorps (Middle Region) (ABIN629816)

Antigène: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRMT1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PRMT1 anticorps

Épitope: Middle Region

Specificité: PRMT1 antibody was raised against the middle region of PRMT1

Purification: Purified

Immunogène: PRMT1 antibody was raised using the middle region of PRMT1 corresponding to a region with amino acids ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRMT1 Blocking Peptide, (ABIN938122), is also available for use as a blocking control in assays to test for specificity of this PRMT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRMT1

Antigène: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Autre désignation: PRMT1

Sujet: PRMT1 is a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4.

Poids moléculaire: 40 kDa (MW of target protein)