HSP70 1A anticorps (Middle Region)

N° du produit ABIN629817

Détail du produit anti-HSP70 1A anticorps

Antigène: HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien, C. elegans, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSP70 1A est non-conjugé

Application: Western Blotting (WB)

Specificité: HSPA1 A antibody was raised against the middle region of HSPA1

Purification: Purified

Immunogène: HSPA1 A antibody was raised using the middle region of HSPA1 corresponding to a region with amino acids SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLV

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSPA1A Blocking Peptide, catalog no. 33R-8583, is also available for use as a blocking control in assays to test for specificity of this HSPA1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSP70 1A

Antigène: HSP70 1A (HSPA1A) (Heat Shock 70kDa Protein 1A (HSPA1A))

Autre désignation: HSPA1A (HSPA1A Produits)

Synonymes: anticorps hsp70-4, anticorps hspa1a, anticorps Hsp70-3, anticorps Hsp70.3, anticorps Hsp72, anticorps hsp68, anticorps hsp70A1, anticorps HSP72, anticorps Hsp70-1, anticorps Hspa1, anticorps Hspa1b, anticorps hsp70-1, anticorps hsp70-1a, anticorps hsp70i, anticorps hsp72, anticorps hspa1, anticorps hspa1b, anticorps HSP70-1, anticorps HSP70-1A, anticorps HSP70I, anticorps HSPA1, anticorps HSPA1A, anticorps HSPA1B, anticorps HSP70-2, anticorps HSPA2, anticorps HSP70, anticorps hspA1A, anticorps heat shock cognate 70-kd protein, tandem duplicate 3, anticorps heat shock 70 kDa protein 1, anticorps heat shock 70 kDa protein II, anticorps heat shock protein 1A, anticorps heat shock 70kD protein 1A, anticorps heat shock protein family A (Hsp70) member 1A S homeolog, anticorps heat shock protein family A (Hsp70) member 1A, anticorps heat shock protein 70.2, anticorps heat shock 70kDa protein 1A, anticorps heat shock 70 kDa protein 1B, anticorps heat shock protein 70.1, anticorps hsp70.3, anticorps LOC100023597, anticorps LOC100554002, anticorps LOC100608888, anticorps Hspa1a, anticorps hspa1a.S, anticorps HSPA1A, anticorps HSP70.2, anticorps LOC100354037, anticorps HSP70.1

Sujet: HSPA1A is a member of the heat shock protein 70 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process