PFKL anticorps (Middle Region)
-
- Antigène Voir toutes PFKL Anticorps
- PFKL (Phosphofructokinase, Liver (PFKL))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PFKL est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PFKL antibody was raised against the middle region of PFKL
- Purification
- Purified
- Immunogène
- PFKL antibody was raised using the middle region of PFKL corresponding to a region with amino acids RTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANA
- Top Product
- Discover our top product PFKL Anticorps primaire
-
anti-Phosphofructokinase, Liver (PFKL) (Center) antibody
PFKL Reactivité: Humain, Souris WB, IHC (p), IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Phosphofructokinase, Liver (PFKL) (AA 229-479) antibodyPFKL Reactivité: Humain WB, ELISA, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Phosphofructokinase, Liver (PFKL) (AA 669-699), (C-Term) antibodyPFKL Reactivité: Humain, Souris WB, IHC (p) Hôte: Lapin Polyclonal RB03903 unconjugated
anti-Phosphofructokinase, Liver (PFKL) (AA 700-780) antibodyPFKL Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Phosphofructokinase, Liver (PFKL) (Middle Region) antibodyPFKL Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cobaye, Cheval, Lapin, Mouton, Poisson zèbre (Danio rerio) WB Hôte: Lapin Polyclonal unconjugated
anti-Phosphofructokinase, Liver (PFKL) (C-Term) antibodyPFKL Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Phosphofructokinase, Liver (PFKL) (C-Term) antibodyPFKL Reactivité: Humain, Souris, Rat WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Phosphofructokinase, Liver (PFKL) (AA 371-399) antibodyPFKL Reactivité: Humain WB Hôte: Lapin Polyclonal RB6851 unconjugated
anti-Phosphofructokinase, Liver (PFKL) (AA 441-540) antibodyPFKL Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 2A9 unconjugated
anti-Phosphofructokinase, Liver (PFKL) (C-Term) antibodyPFKL Reactivité: Humain, Souris, Rat WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PFKL Blocking Peptide, catalog no. 33R-8233, is also available for use as a blocking control in assays to test for specificity of this PFKL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFKL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PFKL (Phosphofructokinase, Liver (PFKL))
- Autre désignation
- PFKL (PFKL Produits)
- Synonymes
- anticorps PFK-B, anticorps AA407869, anticorps phosphofructokinase, liver type, anticorps phosphofructokinase, liver, B-type, anticorps PFKL, anticorps Pfkl
- Sujet
- Phosphofructokinase (PFK) is a tetrameric enzyme that catalyzes a key step in glycolysis, namely the conversion of D-fructose 6-phosphate to D-fructose 1,6-bisphosphate. PFK from muscle is a homotetramer of M subunit, PFK from liver is a homotetramer of L-subunits, while PFK from platelets can be composed of any tetrameric combination of M and L subunits. PFKL represents the L subunit.
- Poids moléculaire
- 64 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, L'effet Warburg
-
