Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M) (N-Term) anticorps

N° du produit ABIN629825

L’anticorps anti-Eukaryotic Translation Initiation Factor 3, Subunit M Polyclonal Lapin est utilisé pour la détection de Eukaryotic Translation Initiation Factor 3, Subunit M dans des échantillons de Humain, Souris et Rat. Il a été validé pour WB et IHC.

Aperçu rapide pour Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M) (N-Term) anticorps (ABIN629825)

Antigène: Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M)

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit

Épitope: N-Term

Specificité: EIF3 M antibody was raised against the N terminal of EIF3

Purification: Purified

Immunogène: EIF3 M antibody was raised using the N terminal of EIF3 corresponding to a region with amino acids MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF3M Blocking Peptide, (ABIN5613334), is also available for use as a blocking control in assays to test for specificity of this EIF3M antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M)

Autre désignation: EIF3M

Sujet: EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization