UROD anticorps (N-Term)

N° du produit ABIN629827

Cet anticorps Lapin Polyclonal détecte spécifiquement UROD dans WB et IHC. Il présente une réactivité envers Humain.

Aperçu rapide pour UROD anticorps (N-Term) (ABIN629827)

Antigène: UROD (Uroporphyrinogen Decarboxylase (UROD))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UROD est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-UROD anticorps

Épitope: N-Term

Specificité: UROD antibody was raised against the N terminal of UROD

Purification: Purified

Immunogène: UROD antibody was raised using the N terminal of UROD corresponding to a region with amino acids SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UROD Blocking Peptide, (ABIN5616924), is also available for use as a blocking control in assays to test for specificity of this UROD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UROD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UROD

Antigène: UROD (Uroporphyrinogen Decarboxylase (UROD))

Autre désignation: UROD

Sujet: UROD is the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.

Poids moléculaire: 40 kDa (MW of target protein)