ZBP1 anticorps (Middle Region)

N° du produit ABIN629830

Détail du produit anti-ZBP1 anticorps

Antigène: ZBP1 (Z-DNA Binding Protein 1 (ZBP1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZBP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZBP1 antibody was raised against the middle region of ZBP1

Purification: Purified

Immunogène: ZBP1 antibody was raised using the middle region of ZBP1 corresponding to a region with amino acids LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZBP1

Antigène: ZBP1 (Z-DNA Binding Protein 1 (ZBP1))

Autre désignation: ZBP1 (ZBP1 Produits)

Synonymes: anticorps C20orf183, anticorps DAI, anticorps DLM-1, anticorps DLM1, anticorps 2010010H03Rik, anticorps Dai, anticorps Dlm1, anticorps mZaDLM, anticorps ZBP1, anticorps Z-DNA binding protein 1, anticorps ZBP1, anticorps Zbp1

Sujet: ZBP1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.

Poids moléculaire: 47 kDa (MW of target protein)