NNMT anticorps (N-Term)

N° du produit ABIN629835

Cet anticorps anti-NNMT est un anticorps Lapin Polyclonal détectant NNMT dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour NNMT anticorps (N-Term) (ABIN629835)

Antigène: NNMT (Nicotinamide N-Methyltransferase (NNMT))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NNMT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NNMT anticorps

Épitope: N-Term

Specificité: NNMT antibody was raised against the N terminal of NNMT

Purification: Purified

Immunogène: NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NNMT Blocking Peptide, (ABIN5615015), is also available for use as a blocking control in assays to test for specificity of this NNMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NNMT

Antigène: NNMT (Nicotinamide N-Methyltransferase (NNMT))

Autre désignation: NNMT

Sujet: N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver.

Poids moléculaire: 29 kDa (MW of target protein)