ADH1B anticorps
-
- Antigène Voir toutes ADH1B Anticorps
- ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADH1B est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- ADH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV
- Top Product
- Discover our top product ADH1B Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ADH1B Blocking Peptide, catalog no. 33R-6775, is also available for use as a blocking control in assays to test for specificity of this ADH1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))
- Autre désignation
- ADH1B (ADH1B Produits)
- Synonymes
- anticorps AO090038000108, anticorps ADH, anticorps Adh-2, anticorps Adh2, anticorps Dvir\\GJ18209, anticorps GJ18209, anticorps dvir_GLEANR_2772, anticorps ADH2, anticorps adh-2, anticorps adh2, anticorps alcohol dehydrogenase 2, anticorps Alcohol dehydrogenase 2, anticorps alcohol dehydrogenase 1B (class I), beta polypeptide, anticorps alcohol dehydrogenase 1B (class I), beta polypeptide L homeolog, anticorps CPR_0442, anticorps AOR_1_236174, anticorps AOR_1_178074, anticorps Dvir\Adh2, anticorps adhB, anticorps ADH2, anticorps ADH1B, anticorps adh1b.L
- Sujet
- ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.
- Poids moléculaire
- 41 kDa (MW of target protein)
-