ATIC anticorps (Middle Region)

N° du produit ABIN629868

Cet anticorps anti-ATIC est un anticorps Lapin Polyclonal détectant ATIC dans WB et IHC. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour ATIC anticorps (Middle Region) (ABIN629868)

Antigène: ATIC (5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATIC est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-ATIC anticorps

Épitope: Middle Region

Specificité: ATIC antibody was raised against the middle region of ATIC

Purification: Purified

Immunogène: ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATIC Blocking Peptide, (ABIN5612214), is also available for use as a blocking control in assays to test for specificity of this ATIC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATIC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATIC

Antigène: ATIC (5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC))

Autre désignation: ATIC

Sujet: ATIC is a bifunctional protein requiring dimerization for transformylase activity.

Poids moléculaire: 30 kDa (MW of target protein)