CHD1L anticorps (Middle Region)

N° du produit ABIN629877

Détail du produit anti-CHD1L anticorps

Antigène: CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHD1L est non-conjugé

Application: Western Blotting (WB)

Specificité: CHD1 L antibody was raised against the middle region of CHD1

Purification: Purified

Immunogène: CHD1 L antibody was raised using the middle region of CHD1 corresponding to a region with amino acids DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHD1L Blocking Peptide, catalog no. 33R-1859, is also available for use as a blocking control in assays to test for specificity of this CHD1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHD1L

Antigène: CHD1L (Chromodomain Helicase DNA Binding Protein 1-Like (CHD1L))

Autre désignation: CHD1L (CHD1L Produits)

Synonymes: anticorps CHD1L, anticorps ALC1, anticorps CHDL, anticorps 4432404A22Rik, anticorps Alc1, anticorps Snf2p, anticorps zgc:56084, anticorps chromodomain helicase DNA binding protein 1 like, anticorps chromodomain helicase DNA binding protein 1-like, anticorps CHD1L, anticorps chd1l, anticorps Chd1l

Sujet: CHD1L encodes a protein that interacts with ADP-ribose. ADP-ribosylation of proteins is an important post-translational modification that occurs in a variety of biological processes, including DNA repair, transcription, chromatin biology and long-term memory formation.

Poids moléculaire: 45 kDa (MW of target protein)