NONO anticorps (C-Term)

N° du produit ABIN629889

Détail du produit anti-NONO anticorps

Antigène: NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NONO est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: NONO antibody was raised against the C terminal of NONO

Purification: Purified

Immunogène: NONO antibody was raised using the C terminal of NONO corresponding to a region with amino acids DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NONO Blocking Peptide, catalog no. 33R-1969, is also available for use as a blocking control in assays to test for specificity of this NONO antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NONO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NONO

Antigène: NONO (Non-POU Domain Containing, Octamer-Binding (NONO))

Autre désignation: NONO (NONO Produits)

Synonymes: anticorps NMT55, anticorps NRB54, anticorps P54, anticorps P54NRB, anticorps nmt55, anticorps nrb54, anticorps p54nrb, anticorps xp54nrb, anticorps AA407051, anticorps AV149256, anticorps nonA, anticorps non-POU domain containing octamer binding, anticorps non-POU domain containing, octamer-binding, anticorps non-POU domain containing, octamer binding L homeolog, anticorps non-POU-domain-containing, octamer binding protein, anticorps NONO, anticorps Nono, anticorps nono.L

Sujet: NONO is DNA- and RNA binding protein, involved in several nuclear processes. It binds the conventional octamer sequence in double stranded DNA. It also binds single-stranded DNA and RNA at a site independent of the duplex site. It is involved in pre-mRNA splicing and interacts with U5 snRNA. The SFPQ-NONO heteromer associated with MATR3 may play a role in nuclear retention of defective RNAs, be involved in DNA unwinding by modulating the function of topoisomerase I/TOP1 and be involved in DNA nonhomologous end joining (NHEJ) required for double-strand break repair and V(D)J recombination and may stabilize paired DNA ends. NONO binds to an enhancer element in long terminal repeats of endogenous intracisternal A particles (IAPs) and activates transcription.

Poids moléculaire: 52 kDa (MW of target protein)