SF3B1 anticorps (N-Term)

N° du produit ABIN629906

L’anticorps Lapin Polyclonal anti-SF3B1 a été validé pour WB et IHC. Il convient pour détecter SF3B1 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour SF3B1 anticorps (N-Term) (ABIN629906)

Antigène: SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SF3B1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SF3B1 anticorps

Épitope: N-Term

Specificité: SF3 B1 antibody was raised against the N terminal of SF3 1

Purification: Purified

Immunogène: SF3 B1 antibody was raised using the N terminal of SF3 1 corresponding to a region with amino acids MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SF3B1 Blocking Peptide, (ABIN5616087), is also available for use as a blocking control in assays to test for specificity of this SF3B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SF3B1

Antigène: SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))

Autre désignation: SF3B1

Sujet: SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

Poids moléculaire: 143 kDa (MW of target protein)

Pathways: Chromatin Binding