EXOSC3 anticorps (C-Term)

N° du produit ABIN629919

Cet anticorps anti-EXOSC3 est un anticorps Lapin Polyclonal détectant EXOSC3 dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour EXOSC3 anticorps (C-Term) (ABIN629919)

Antigène: EXOSC3 (Exosome Component 3 (EXOSC3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EXOSC3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-EXOSC3 anticorps

Épitope: C-Term

Specificité: EXOSC3 antibody was raised against the C terminal of EXOSC3

Purification: Purified

Immunogène: EXOSC3 antibody was raised using the C terminal of EXOSC3 corresponding to a region with amino acids PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EXOSC3 Blocking Peptide, (ABIN5613432), is also available for use as a blocking control in assays to test for specificity of this EXOSC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EXOSC3

Antigène: EXOSC3 (Exosome Component 3 (EXOSC3))

Autre désignation: EXOSC3

Sujet: EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, SARS-CoV-2 Protein Interactome