CDKN2AIP anticorps (C-Term)

N° du produit ABIN629922

Cet anticorps anti-CDKN2AIP est un anticorps Lapin Polyclonal détectant CDKN2AIP dans WB et IHC. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour CDKN2AIP anticorps (C-Term) (ABIN629922)

Antigène: CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CDKN2AIP est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-CDKN2AIP anticorps

Épitope: C-Term

Specificité: CARF antibody was raised against the C terminal Of Carf

Purification: Purified

Immunogène: CARF antibody was raised using the C terminal Of Carf corresponding to a region with amino acids AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS

Information d'application

Indications d'application: WB: 0.3125 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CARF Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CARF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CARF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CDKN2AIP

Antigène: CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))

Autre désignation: CARF

Sujet: CARF was first cloned as a novel binding partner of ARF from a yeast-interactive screen. CARF and ARF colocalize in the perinucleolar region and have a collaborative function. In the nucleoplasm, CARF interacts with p53 and enhances its function. The p53 downregulates CARF in a negative feedback regulatory loop and may also involve p53 antagonist HDM2.

Poids moléculaire: 64 kDa (MW of target protein)