CPEB2 anticorps (Middle Region)

N° du produit ABIN629930

Détail du produit anti-CPEB2 anticorps

Antigène: CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio), Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPEB2 est non-conjugé

Application: Western Blotting (WB)

Specificité: CPEB2 antibody was raised against the middle region of CPEB2

Purification: Purified

Immunogène: CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CPEB2 Blocking Peptide, catalog no. 33R-2191, is also available for use as a blocking control in assays to test for specificity of this CPEB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPEB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CPEB2

Antigène: CPEB2 (Cytoplasmic Polyadenylation Element Binding Protein 2 (CPEB2))

Autre désignation: CPEB2 (CPEB2 Produits)

Synonymes: anticorps CPE-BP2, anticorps CPEB-2, anticorps hCPEB-2, anticorps A630055H10Rik, anticorps Cpe-bp2, anticorps CPEB2, anticorps DKFZp469M211, anticorps cytoplasmic polyadenylation element binding protein 2, anticorps cytoplasmic polyadenylation element-binding protein 2, anticorps CPEB2, anticorps Cpeb2, anticorps cpeb2, anticorps LOC100351062

Sujet: CPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.

Poids moléculaire: 37 kDa (MW of target protein)