NOVA2 anticorps (Middle Region)

N° du produit ABIN629943

Cet anticorps anti-NOVA2 est un anticorps Lapin Polyclonal détectant NOVA2 dans WB. Adapté pour Humain, Souris, Rat et Chien.

Aperçu rapide pour NOVA2 anticorps (Middle Region) (ABIN629943)

Antigène: NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOVA2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-NOVA2 anticorps

Épitope: Middle Region

Specificité: NOVA2 antibody was raised against the middle region of NOVA2

Purification: Purified

Immunogène: NOVA2 antibody was raised using the middle region of NOVA2 corresponding to a region with amino acids EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASP

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NOVA2 Blocking Peptide, (ABIN938017), is also available for use as a blocking control in assays to test for specificity of this NOVA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOVA2

Antigène: NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))

Autre désignation: NOVA2

Sujet: NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.

Poids moléculaire: 54 kDa (MW of target protein)