RPS14 anticorps (Middle Region)

N° du produit ABIN629964

Détail du produit anti-RPS14 anticorps

Antigène: RPS14 (Ribosomal Protein S14 (RPS14))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), Chien, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS14 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPS14 antibody was raised against the middle region of RPS14

Purification: Purified

Immunogène: RPS14 antibody was raised using the middle region of RPS14 corresponding to a region with amino acids GNRTKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRRGRRL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS14 Blocking Peptide, catalog no. 33R-3457, is also available for use as a blocking control in assays to test for specificity of this RPS14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS14

Antigène: RPS14 (Ribosomal Protein S14 (RPS14))

Autre désignation: RPS14 (RPS14 Produits)

Synonymes: anticorps EMTB, anticorps S14, anticorps 2600014J02Rik, anticorps AL023078, anticorps fa92e08, anticorps wu:fa92e08, anticorps zgc:73215, anticorps CG1527, anticorps Dmel\CG1527, anticorps RPS14B, anticorps RpS14, anticorps RpS14B, anticorps S14b, anticorps anon-EST:Posey115, anticorps anon-EST:Posey131, anticorps anon-EST:Posey154, anticorps anon-EST:Posey77, anticorps rpS14B, anticorps ribosomal protein S14, anticorps 40S ribosomal protein S14, anticorps ribosomal protein S14 L homeolog, anticorps 30S ribosomal protein S14, anticorps Ribosomal protein S14b, anticorps mitochondrial ribosomal protein S14, anticorps RPS14, anticorps Rps14, anticorps rps-14, anticorps rps14, anticorps rps14.L, anticorps LOC100286294, anticorps RpS14, anticorps RpS14b, anticorps MRPS14

Sujet: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPS14 is a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Poids moléculaire: 17 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly