MSI2 anticorps

N° du produit ABIN629967

Cet anticorps anti-MSI2 est un anticorps Lapin Polyclonal détectant MSI2 dans WB et IHC. Adapté pour Humain, Souris, Rat, Poisson zèbre (Danio rerio) et C. elegans.

Aperçu rapide pour MSI2 anticorps (ABIN629967)

Antigène: MSI2 (Musashi Homolog 2 (MSI2))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MSI2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-MSI2 anticorps

Purification: Purified

Immunogène: MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MSI2 Blocking Peptide, (ABIN5614853), is also available for use as a blocking control in assays to test for specificity of this MSI2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MSI2

Antigène: MSI2 (Musashi Homolog 2 (MSI2))

Autre désignation: MSI2

Sujet: MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.

Poids moléculaire: 36 kDa (MW of target protein)