MSI2 anticorps

N° du produit ABIN629967

Détail du produit anti-MSI2 anticorps

Antigène: MSI2 (Musashi Homolog 2 (MSI2))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio), C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MSI2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MSI2 Blocking Peptide, catalog no. 33R-5352, is also available for use as a blocking control in assays to test for specificity of this MSI2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MSI2

Antigène: MSI2 (Musashi Homolog 2 (MSI2))

Autre désignation: MSI2 (MSI2 Produits)

Synonymes: anticorps MSI2H, anticorps 1700105C15Rik, anticorps AI451722, anticorps AI563628, anticorps AW489193, anticorps Msi2h, anticorps RGD1560397, anticorps MSI2, anticorps musashi-2, anticorps musashi2, anticorps xrp1, anticorps msi2, anticorps zgc:174035, anticorps zgc:63812, anticorps cb746, anticorps fi47b09, anticorps wu:fb02d08, anticorps wu:fi32d12, anticorps wu:fi47b09, anticorps musashi RNA binding protein 2, anticorps musashi RNA-binding protein 2, anticorps musashi RNA binding protein 2 S homeolog, anticorps musashi RNA-binding protein 2b, anticorps musashi RNA-binding protein 2a, anticorps MSI2, anticorps Msi2, anticorps msi2.S, anticorps msi2, anticorps msi2b, anticorps msi2a

Sujet: MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation.

Poids moléculaire: 36 kDa (MW of target protein)