FARS2 anticorps (N-Term)

N° du produit ABIN629969

L’anticorps Lapin Polyclonal anti-FARS2 a été validé pour WB et IHC. Il convient pour détecter FARS2 dans des échantillons de Humain.

Aperçu rapide pour FARS2 anticorps (N-Term) (ABIN629969)

Antigène: FARS2 (Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FARS2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-FARS2 anticorps

Épitope: N-Term

Specificité: FARS2 antibody was raised against the N terminal of FARS2

Purification: Purified

Immunogène: FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FARS2 Blocking Peptide, (ABIN5613517), is also available for use as a blocking control in assays to test for specificity of this FARS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FARS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FARS2

Antigène: FARS2 (Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2))

Autre désignation: FARS2

Sujet: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS2 is a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm.

Poids moléculaire: 50 kDa (MW of target protein)