PTBP2 anticorps (N-Term)

N° du produit ABIN629977

Cet anticorps Lapin Polyclonal détecte spécifiquement PTBP2 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour PTBP2 anticorps (N-Term) (ABIN629977)

Antigène: PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PTBP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PTBP2 anticorps

Épitope: N-Term

Specificité: PTBP2 antibody was raised against the N terminal of PTBP2

Purification: Purified

Immunogène: PTBP2 antibody was raised using the N terminal of PTBP2 corresponding to a region with amino acids MDGIVTEVAVGVKRGSDELLSGSVLSSPNSNMSSMVVTANGNDSKKFKGE

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PTBP2 Blocking Peptide, (ABIN5615645), is also available for use as a blocking control in assays to test for specificity of this PTBP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PTBP2

Antigène: PTBP2 (Polypyrimidine Tract Binding Protein 2 (PTBP2))

Autre désignation: PTBP2

Sujet: PTBP2 binds to the intronic cluster of RNA regulatory elements, downstream control sequence (DCS). It is implicated in controlling the assembly of other splicing-regulatory proteins. This protein is very similar to the polypyrimidine tract binding protein but it is expressed primarily in the brain.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, SARS-CoV-2 Protein Interactome