SF3B4 anticorps (N-Term)

N° du produit ABIN629981

L’anticorps Lapin Polyclonal anti-SF3B4 a été validé pour WB et IHC. Il convient pour détecter SF3B4 dans des échantillons de Humain, Souris, Rat, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour SF3B4 anticorps (N-Term) (ABIN629981)

Antigène: SF3B4 (Splicing Factor 3b, Subunit 4, 49kDa (SF3B4))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SF3B4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SF3B4 anticorps

Épitope: N-Term

Specificité: SF3 B4 antibody was raised against the N terminal of SF3 4

Purification: Purified

Immunogène: SF3 B4 antibody was raised using the N terminal of SF3 4 corresponding to a region with amino acids QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SF3B4 Blocking Peptide, (ABIN5616091), is also available for use as a blocking control in assays to test for specificity of this SF3B4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SF3B4

Antigène: SF3B4 (Splicing Factor 3b, Subunit 4, 49kDa (SF3B4))

Autre désignation: SF3B4

Sujet: SF3B4 is one of four subunits of the splicing factor 3B. The protein cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.

Poids moléculaire: 47 kDa (MW of target protein)