SF3B4 anticorps (N-Term)

N° du produit ABIN629981

Détail du produit anti-SF3B4 anticorps

Antigène: SF3B4 (Splicing Factor 3b, Subunit 4, 49kDa (SF3B4))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SF3B4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SF3 B4 antibody was raised against the N terminal of SF3 4

Purification: Purified

Immunogène: SF3 B4 antibody was raised using the N terminal of SF3 4 corresponding to a region with amino acids QDATVYVGGLDEKVSEPLLWELFLQAGPVVNTHMPKDRVTGQHQGYGFVE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SF3B4 Blocking Peptide, catalog no. 33R-7491, is also available for use as a blocking control in assays to test for specificity of this SF3B4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SF3B4

Antigène: SF3B4 (Splicing Factor 3b, Subunit 4, 49kDa (SF3B4))

Autre désignation: SF3B4 (SF3B4 Produits)

Synonymes: anticorps chunp6902, anticorps fb36a04, anticorps wu:fb36a04, anticorps 49kDa, anticorps SF3b49, anticorps SF3b50, anticorps Sap49, anticorps spx, anticorps AFD1, anticorps Hsh49, anticorps SAP49, anticorps Splicing factor 3B subunit 4, anticorps splicing factor 3b, subunit 4, anticorps splicing factor 3b subunit 4 S homeolog, anticorps splicing factor 3b subunit 4, anticorps sap-49, anticorps sf3b4, anticorps Sf3b4, anticorps sf3b4.S, anticorps SF3B4

Sujet: SF3B4 is one of four subunits of the splicing factor 3B. The protein cross-links to a region in the pre-mRNA immediately upstream of the branchpoint sequence in pre-mRNA in the prespliceosomal complex A. It also may be involved in the assembly of the B, C and E spliceosomal complexes. In addition to RNA-binding activity, this protein interacts directly and highly specifically with subunit 2 of the splicing factor 3B. This protein contains two N-terminal RNA-recognition motifs (RRMs), consistent with the observation that it binds directly to pre-mRNA.

Poids moléculaire: 47 kDa (MW of target protein)