NIP7 anticorps
-
- Antigène Voir toutes NIP7 Anticorps
- NIP7 (Nuclear Import 7 Homolog (NIP7))
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NIP7 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- NIP7 antibody was raised using a synthetic peptide corresponding to a region with amino acids VVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
- Top Product
- Discover our top product NIP7 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NIP7 Blocking Peptide, catalog no. 33R-9905, is also available for use as a blocking control in assays to test for specificity of this NIP7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIP7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NIP7 (Nuclear Import 7 Homolog (NIP7))
- Autre désignation
- NIP7 (NIP7 Produits)
- Synonymes
- anticorps HSPC031, anticorps KD93, anticorps CGI-37, anticorps Nip7p, anticorps pEachy, anticorps zgc:110384, anticorps nip7, anticorps Nip7, anticorps ACYPI003208, anticorps NIP7, anticorps DKFZp468F182, anticorps 1110017C15Rik, anticorps 6330509M23Rik, anticorps AA408773, anticorps AA410017, anticorps PEachy, anticorps NIP7, nucleolar pre-rRNA processing protein, anticorps NIP7, nucleolar pre-rRNA processing protein L homeolog, anticorps 60S ribosome subunit biogenesis protein NIP7 homolog, anticorps NIP7, anticorps Nip7, anticorps nip7.L, anticorps nip7
- Sujet
- NIP7 contains 1PUA domain and belongs to the NIP7 family. It may play a role in 60S ribosomal subunit synthesis.
- Poids moléculaire
- 20 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly
-