EIF2S1 anticorps (C-Term)

N° du produit ABIN629992

Détail du produit anti-EIF2S1 anticorps

Antigène: EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))

Épitope: C-Term

Reactivité: Humain, Rat, Souris, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EIF2S1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: EIF2 S1 antibody was raised against the C terminal of EIF2 1

Purification: Purified

Immunogène: EIF2 S1 antibody was raised using the C terminal of EIF2 1 corresponding to a region with amino acids RGVFNVQMEPKVVTDTDETELARQMERLERENAEVDGDDDAEEMEAKAED

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF2S1 Blocking Peptide, catalog no. 33R-7946, is also available for use as a blocking control in assays to test for specificity of this EIF2S1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EIF2S1

Antigène: EIF2S1 (Eukaryotic Translation Initiation Factor 2 Subunit 1 (EIF2S1))

Autre désignation: EIF2S1 (EIF2S1 Produits)

Synonymes: anticorps EIF-2, anticorps EIF-2A, anticorps EIF-2alpha, anticorps EIF2, anticorps EIF2A, anticorps Eif2s1, anticorps eif2s1l, anticorps fb36a08, anticorps wu:fb36a08, anticorps zgc:56510, anticorps 0910001O23Rik, anticorps 2410026C18Rik, anticorps 35kDa, anticorps Eif2a, anticorps eIF2alpha, anticorps eif2a, anticorps CG9946, anticorps Dmel\\CG9946, anticorps Eif2alpha, anticorps IF2A_DROME, anticorps M(1)14C, anticorps M(1)19-153, anticorps M(1)8e3-10, anticorps deIF2alpha, anticorps eIF-2, anticorps eIF-2 a, anticorps eIF-2 alpha, anticorps eIF2 alpha, anticorps eIF2-alpha, anticorps eIF2a, anticorps eiF-2alpha, anticorps elF2alpha, anticorps l(1)14Cf, anticorps l(1)19-153, anticorps eukaryotic translation initiation factor 2 subunit alpha, anticorps eukaryotic translation initiation factor 2, subunit 1 alpha a, anticorps eukaryotic translation initiation factor 2, subunit 1 alpha, anticorps eukaryotic translation initiation factor 2 alpha subunit, anticorps Eukaryotic translation initiation factor 2 subunit 1, anticorps eukaryotic translation initiation factor 2 subunit alpha L homeolog, anticorps eukaryotic translation Initiation Factor 2alpha, anticorps EIF2S1, anticorps eif2s1a, anticorps Eif2s1, anticorps eif2s1, anticorps LOC693063, anticorps CNI00230, anticorps THAPSDRAFT_105, anticorps if2a, anticorps eif2s1.L, anticorps eIF-2alpha

Sujet: The translation initiation factor eIF2 catalyzes the first regulated step of protein synthesis initiation, promoting the binding of the initiator tRNA to 40S ribosomal subunits. Binding occurs as a ternary complex of methionyl-tRNA, eIF2, and GTP. eIF2 is composed of 3 nonidentical subunits, alpha (36 kDa), beta (38 kDa), and gamma (52 kDa). The rate of formation of the ternary complex is modulated by the phosphorylation state of eIF2-alpha.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, ER-Nucleus Signaling, Hepatitis C