SFPQ anticorps

N° du produit ABIN629995

Cet anticorps Lapin Polyclonal détecte spécifiquement SFPQ dans WB et IHC. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour SFPQ anticorps (ABIN629995)

Antigène: SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFPQ est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SFPQ anticorps

Purification: Purified

Immunogène: SFPQ antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFPQ Blocking Peptide, (ABIN5616098), is also available for use as a blocking control in assays to test for specificity of this SFPQ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFPQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFPQ

Antigène: SFPQ (Splicing Factor Proline/glutamine-Ric (SFPQ))

Autre désignation: SFPQ

Sujet: SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A.

Poids moléculaire: 78 kDa (MW of target protein)