MIF4GD anticorps (C-Term)

N° du produit ABIN630025

Cet anticorps Lapin Polyclonal détecte spécifiquement MIF4GD dans WB et IHC. Il présente une réactivité envers Humain, Souris, Chien et Rat.

Aperçu rapide pour MIF4GD anticorps (C-Term) (ABIN630025)

Antigène: MIF4GD (MIF4G Domain Containing (MIF4GD))

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MIF4GD est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-MIF4GD anticorps

Épitope: C-Term

Specificité: MIF4 GD antibody was raised against the C terminal of MIF4 D

Purification: Purified

Immunogène: MIF4 GD antibody was raised using the C terminal of MIF4 D corresponding to a region with amino acids LFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MIF4GD Blocking Peptide, (ABIN940340), is also available for use as a blocking control in assays to test for specificity of this MIF4GD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MIF0 D antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MIF4GD

Antigène: MIF4GD (MIF4G Domain Containing (MIF4GD))

Autre désignation: MIF4GD

Sujet: MIF4GD is a protein which contains an MIF4G domain.

Poids moléculaire: 28 kDa (MW of target protein)