RBM4B anticorps (C-Term)

N° du produit ABIN630027

Cet anticorps anti-RBM4B est un anticorps Lapin Polyclonal détectant RBM4B dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour RBM4B anticorps (C-Term) (ABIN630027)

Antigène: RBM4B (RNA Binding Motif Protein 4B (RBM4B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM4B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RBM4B anticorps

Épitope: C-Term

Specificité: RBM4 B antibody was raised against the C terminal of RBM4

Purification: Purified

Immunogène: RBM4 B antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM4B Blocking Peptide, (ABIN935962), is also available for use as a blocking control in assays to test for specificity of this RBM4B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM4B

Antigène: RBM4B (RNA Binding Motif Protein 4B (RBM4B))

Autre désignation: RBM4B

Sujet: RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Photoperiodism