RBM4B anticorps (C-Term)

N° du produit ABIN630027

Détail du produit anti-RBM4B anticorps

Antigène: RBM4B (RNA Binding Motif Protein 4B (RBM4B))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBM4B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RBM4 B antibody was raised against the C terminal of RBM4

Purification: Purified

Immunogène: RBM4 B antibody was raised using the C terminal of RBM4 corresponding to a region with amino acids AAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBM4B Blocking Peptide, catalog no. 33R-1001, is also available for use as a blocking control in assays to test for specificity of this RBM4B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBM4B

Antigène: RBM4B (RNA Binding Motif Protein 4B (RBM4B))

Autre désignation: RBM4B (RBM4B Produits)

Synonymes: anticorps RBM30, anticorps RBM4L, anticorps ZCCHC15, anticorps ZCCHC21B, anticorps ZCRB3B, anticorps 4921506I22Rik, anticorps AI504630, anticorps AI506404, anticorps Lark2, anticorps rbm4, anticorps rbm30, anticorps rbm4l, anticorps zcrb3b, anticorps zcchc15, anticorps MGC75893, anticorps RBM4B, anticorps RNA binding motif protein 4B, anticorps RNA binding motif protein 4B L homeolog, anticorps RNA-binding protein 4B, anticorps RBM4B, anticorps Rbm4b, anticorps rbm4b, anticorps rbm4b.L, anticorps LOC713553, anticorps LOC102180196, anticorps LOC100058729

Sujet: RBM4B contains 1 CCHC-type zinc finger and 2 RRM (RNA recognition motif) domains. It may play a role in alternative splice site selection during pre-mRNA processing.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Photoperiodism