Cytokeratin 18 anticorps (N-Term)

N° du produit ABIN630047

L’anticorps Lapin Polyclonal anti-Cytokeratin 18 a été validé pour WB et IHC. Il convient pour détecter Cytokeratin 18 dans des échantillons de Humain.

Aperçu rapide pour Cytokeratin 18 anticorps (N-Term) (ABIN630047)

Antigène: Cytokeratin 18 (KRT18) (Keratin 18 (KRT18))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cytokeratin 18 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Cytokeratin 18 anticorps

Épitope: N-Term

Specificité: Cytokeratin 18 antibody was raised against the N terminal of KRT18

Purification: Purified

Immunogène: Cytokeratin 18 antibody was raised using the N terminal of KRT18 corresponding to a region with amino acids TRSTFSTNYRSLGSVQAPSYGARPVSSAASVYAGAGGSGSRISVSRSTSF

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Cytokeratin 18 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cytokeratin 18

Antigène: Cytokeratin 18 (KRT18) (Keratin 18 (KRT18))

Autre désignation: Cytokeratin 18

Sujet: KRT18 (Keratin 18) is type I intermediate filament chain. Keratin 18, together with its filament partner keratin 8, are perhaps the most commonly found members of the intermediate filament gene family. They are expressed in single layer epithelial tissues of the body. Mutations in this gene have been linked to cryptogenic cirrhosis.KRT18 encodes the type I intermediate filament chain keratin 18.

Poids moléculaire: 47 kDa (MW of target protein)

Pathways: Apoptose, Caspase Cascade in Apoptosis