DDX41 anticorps

N° du produit ABIN630056

Détail du produit anti-DDX41 anticorps

Antigène: DDX41 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX41 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: DDX41 antibody was raised using a synthetic peptide corresponding to a region with amino acids AIHEYLLLKGVEAVAIHGGKDQEERTKAIEAFREGKKDVLVATDVASKGL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX41 Blocking Peptide, catalog no. 33R-1267, is also available for use as a blocking control in assays to test for specificity of this DDX41 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX41 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX41

Antigène: DDX41 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 41 (DDX41))

Autre désignation: DDX41 (DDX41 Produits)

Synonymes: anticorps DDX41, anticorps ABS, anticorps 2900024F02Rik, anticorps AA958953, anticorps AI324246, anticorps wu:fb92e02, anticorps zgc:55896, anticorps DEAD-box helicase 41, anticorps probable ATP-dependent RNA helicase DDX41, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 41, anticorps DDX41, anticorps LOC100215941, anticorps ddx41, anticorps LOC100638079, anticorps Ddx41

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Based on studies in Drosophila, the abstrakt gene is widely required during post-transcriptional gene expression.

Poids moléculaire: 68 kDa (MW of target protein)