CATSPER2 anticorps (N-Term)

N° du produit ABIN630061

Détail du produit anti-CATSPER2 anticorps

Antigène: CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CATSPER2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: CATSPER2 antibody was raised against the N terminal of CATSPER2

Purification: Purified

Immunogène: CATSPER2 antibody was raised using the N terminal of CATSPER2 corresponding to a region with amino acids HLQGLSQAVPRHTIRELLDPSRQKKLVLGDQHQLVRFSIKPQRIEQISHA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CATSPER2 Blocking Peptide, catalog no. 33R-3784, is also available for use as a blocking control in assays to test for specificity of this CATSPER2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CATSPER2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CATSPER2

Antigène: CATSPER2 (Cation Channel, Sperm Associated 2 (CATSPER2))

Autre désignation: CATSPER2 (CATSPER2 Produits)

Synonymes: anticorps CATSPER2, anticorps cation channel, sperm associated 2, anticorps cation channel sperm associated 2, anticorps CATSPER2, anticorps Catsper2

Sujet: Calcium ions play a primary role in the regulation of sperm motility. Anti-CATSPER2 belongs to a family of putative cation channels that are specific to spermatozoa and localize to the flagellum. The protein family features a single repeat with six membrane-spanning segments and a predicted calcium-selective pore region. A second, closely linked copy of this gene has been identified. Although multiple transcript variants encoding protein isoforms have been characterized, they seem to be only transcribed from this gene. Additional splice variants have been described but their full-length nature has not been determined.

Poids moléculaire: 46 kDa (MW of target protein)