Bestrophin 4 anticorps (N-Term)

N° du produit ABIN630067

Détail du produit anti-Bestrophin 4 anticorps

Antigène: Bestrophin 4 (BEST4)

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Bestrophin 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: VMD2 L2 antibody was raised against the N terminal Of Vmd2 2

Purification: Purified

Immunogène: VMD2 L2 antibody was raised using the N terminal Of Vmd2 2 corresponding to a region with amino acids MTVSYTLKVAEARFGGFSGLLLRWRGSIYKLLYKEFLLFGALYAVLSITY

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VMD2L2 Blocking Peptide, catalog no. 33R-6572, is also available for use as a blocking control in assays to test for specificity of this VMD2L2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VMD0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Bestrophin 4

Antigène: Bestrophin 4 (BEST4)

Autre désignation: VMD2L2 (BEST4 Produits)

Synonymes: anticorps CG7259, anticorps CT22395, anticorps Dmel\\CG7259, anticorps dbest4, anticorps BEST4, anticorps VMD2L2, anticorps vmd2l2, anticorps Bestrophin 4, anticorps bestrophin 4, anticorps Best4, anticorps BEST4, anticorps best4

Sujet: VMD2L2 is 1 of 3 VMD2-like genes which encode transmembrane spanning proteins that share a homology region with a high content of aromatic residues including an invariant arginine (R), phenylalanine (F), and proline (P) motif.

Poids moléculaire: 52 kDa (MW of target protein)