RED1 anticorps

N° du produit ABIN630123

Cet anticorps anti-RED1 Polyclonal Lapin (ABIN630123) détecte spécifiquement RED1 dans WB. L’anticorps est réactif avec des échantillons de Humain, Rat et Souris.

Aperçu rapide pour RED1 anticorps (ABIN630123)

Antigène: RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RED1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RED1 anticorps

Purification: Purified

Immunogène: ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADARB1 Blocking Peptide, (ABIN5611941), is also available for use as a blocking control in assays to test for specificity of this ADARB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADARB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RED1

Antigène: RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))

Autre désignation: ADARB1

Sujet: ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.

Poids moléculaire: 77 kDa (MW of target protein)