RED1 anticorps

N° du produit ABIN630123

Détail du produit anti-RED1 anticorps

Antigène: RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RED1 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADARB1 Blocking Peptide, catalog no. 33R-7645, is also available for use as a blocking control in assays to test for specificity of this ADARB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADARB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RED1

Antigène: RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))

Autre désignation: ADARB1 (ADARB1 Produits)

Synonymes: anticorps ADARB1, anticorps RED1, anticorps ADAR2, anticorps DRABA2, anticorps DRADA2, anticorps 1700057H01Rik, anticorps AW124433, anticorps AW558573, anticorps Adar2, anticorps BB220382, anticorps D10Bwg0447e, anticorps Red1, anticorps adar2, anticorps adarb1, anticorps red1, anticorps adenosine deaminase, RNA specific B1, anticorps adenosine deaminase, RNA-specific, B1, anticorps adenosine deaminase, RNA-specific, B1 L homeolog, anticorps adenosine deaminase, RNA-specific, B1a, anticorps ADARB1, anticorps adarb1, anticorps adarb1.L, anticorps Adarb1, anticorps adarb1a

Sujet: ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.

Poids moléculaire: 77 kDa (MW of target protein)