MMP1 anticorps
-
- Antigène Voir toutes MMP1 Anticorps
- MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MMP1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- MMP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF
- Top Product
- Discover our top product MMP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MMP1 Blocking Peptide, catalog no. 33R-6984, is also available for use as a blocking control in assays to test for specificity of this MMP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))
- Autre désignation
- MMP1 (MMP1 Produits)
- Synonymes
- anticorps CLG, anticorps CLGN, anticorps Mmp1a, anticorps CG4859, anticorps Dm1-MMP, anticorps Dmel\\CG4859, anticorps MMP-1, anticorps MMP1, anticorps Mmp 1, anticorps dMMP1, anticorps dm1-MMP, anticorps dmmp1, anticorps l(2)k04809, anticorps mmp1, anticorps Mmp1, anticorps Mcol-A, anticorps Mcola, anticorps col4, anticorps mmp18, anticorps Clgn, anticorps matrix metallopeptidase 1, anticorps Matrix metalloproteinase 1, anticorps matrix metalloproteinase 1, anticorps matrix metallopeptidase 1 (interstitial collagenase), anticorps matrix metallopeptidase 1a (interstitial collagenase), anticorps matrix metallopeptidase 1 S homeolog, anticorps interstitial collagenase, anticorps matrix metallopeptidase 8 L homeolog, anticorps MMP1, anticorps Mmp1, anticorps RB11133, anticorps Mmp1a, anticorps mmp1.S, anticorps LOC100727966, anticorps mmp8.L
- Sujet
- Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.
- Poids moléculaire
- 52 kDa (MW of target protein)
-