MMP1 anticorps

N° du produit ABIN630129

Cet anticorps anti-MMP1 Polyclonal Lapin (ABIN630129) détecte spécifiquement MMP1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour MMP1 anticorps (ABIN630129)

Antigène: MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MMP1 anticorps

Purification: Purified

Immunogène: MMP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKA

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MMP1 Blocking Peptide, (ABIN936172), is also available for use as a blocking control in assays to test for specificity of this MMP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MMP1

Antigène: MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))

Autre désignation: MMP1

Sujet: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.

Poids moléculaire: 52 kDa (MW of target protein)