NAGS anticorps (C-Term)

N° du produit ABIN630135

Détail du produit anti-NAGS anticorps

Antigène: NAGS (N-Acetylglutamate Synthase (NAGS))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NAGS est non-conjugé

Application: Western Blotting (WB)

Specificité: NAGS antibody was raised against the C terminal of NAGS

Purification: Purified

Immunogène: NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NAGS Blocking Peptide, catalog no. 33R-10162, is also available for use as a blocking control in assays to test for specificity of this NAGS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAGS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NAGS

Antigène: NAGS (N-Acetylglutamate Synthase (NAGS))

Autre désignation: NAGS (NAGS Produits)

Synonymes: anticorps VF0585, anticorps AGAS, anticorps ARGA, anticorps 1700120E20Rik, anticorps argA, anticorps RGD1565783, anticorps N-acetylglutamate synthase, anticorps amino-acid acetyltransferase ArgA, anticorps argA, anticorps ECs3675, anticorps VP2371, anticorps Psyr_0254, anticorps Sde_0360, anticorps NAGS, anticorps Nags

Sujet: NAGS is a mitochondrial enzyme that catalyzes the formation of N-acetylglutamate (NAG) from glutamate and acetyl coenzyme-A. NAG is a cofactor of carbamyl phosphate synthetase I (CPSI), the first enzyme of the urea cycle in mammals. Deficiencies in N-acetylglutamate synthase have been associated with hyperammonemia.

Poids moléculaire: 58 kDa (MW of target protein)