SDF2 anticorps (N-Term)

N° du produit ABIN630142

Cet anticorps Lapin Polyclonal détecte spécifiquement SDF2 dans WB et IHC. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour SDF2 anticorps (N-Term) (ABIN630142)

Antigène: SDF2 (Stromal Cell Derived Factor 2 (SDF2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SDF2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-SDF2 anticorps

Épitope: N-Term

Specificité: SDF2 antibody was raised against the N terminal of SDF2

Purification: Purified

Immunogène: SDF2 antibody was raised using the N terminal of SDF2 corresponding to a region with amino acids KLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVC

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SDF2 Blocking Peptide, (ABIN939904), is also available for use as a blocking control in assays to test for specificity of this SDF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SDF2

Antigène: SDF2 (Stromal Cell Derived Factor 2 (SDF2))

Autre désignation: SDF2

Sujet: SDF2 is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome