PLAP anticorps

N° du produit ABIN630143

L’anticorps Lapin Polyclonal anti-PLAP a été validé pour WB et IHC. Il convient pour détecter PLAP dans des échantillons de Humain.

Aperçu rapide pour PLAP anticorps (ABIN630143)

Antigène: PLAP (ALPP) (Placental Alkaline Phosphatase (ALPP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLAP est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-PLAP anticorps

Purification: Purified

Immunogène: ALPP antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALPP Blocking Peptide, (ABIN5612037), is also available for use as a blocking control in assays to test for specificity of this ALPP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLAP

Antigène: PLAP (ALPP) (Placental Alkaline Phosphatase (ALPP))

Autre désignation: ALPP

Sujet: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. ALPP is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form.

Poids moléculaire: 59 kDa (MW of target protein)