Renin anticorps (C-Term)

N° du produit ABIN630157

Détail du produit anti-Renin anticorps

Antigène: Renin (REN)

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Renin est non-conjugé

Application: Western Blotting (WB)

Specificité: Renin antibody was raised against the C terminal of REN

Purification: Purified

Immunogène: Renin antibody was raised using the C terminal of REN corresponding to a region with amino acids YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Renin Blocking Peptide, catalog no. 33R-10250, is also available for use as a blocking control in assays to test for specificity of this Renin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Renin

Antigène: Renin (REN)

Autre désignation: Renin (REN Produits)

Synonymes: anticorps HNFJ2, anticorps RATRENAA, anticorps RENAA, anticorps Ren1, anticorps D19352, anticorps Ren, anticorps Ren-1, anticorps Ren-A, anticorps Ren1c, anticorps Ren1d, anticorps Rn-1, anticorps Rnr, anticorps renin, anticorps renin 1 structural, anticorps REN, anticorps Ren, anticorps Ren1, anticorps ren

Sujet: Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Mutations in this gene have been shown to cause familial hyperproreninemia.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, Feeding Behaviour