RSAD2 anticorps (C-Term)

N° du produit ABIN630161

L’anticorps Lapin Polyclonal anti-RSAD2 a été validé pour WB et IHC. Il convient pour détecter RSAD2 dans des échantillons de Humain, Souris, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour RSAD2 anticorps (C-Term) (ABIN630161)

Antigène: RSAD2 (Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2))

Reactivité: Humain, Souris, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RSAD2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-RSAD2 anticorps

Épitope: C-Term

Specificité: RSAD2 antibody was raised against the C terminal of RSAD2

Purification: Purified

Immunogène: RSAD2 antibody was raised using the C terminal of RSAD2 corresponding to a region with amino acids YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RSAD2 Blocking Peptide, (ABIN936140), is also available for use as a blocking control in assays to test for specificity of this RSAD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RSAD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RSAD2

Antigène: RSAD2 (Radical S-Adenosyl Methionine Domain Containing 2 (RSAD2))

Autre désignation: RSAD2

Sujet: RSAD2 is a potential antiviral effector.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response