PSG1 anticorps (C-Term)

N° du produit ABIN630163

Cet anticorps Lapin Polyclonal détecte spécifiquement PSG1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour PSG1 anticorps (C-Term) (ABIN630163)

Antigène: PSG1 (Pregnancy Specific beta-1-Glycoprotein 1 (PSG1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSG1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PSG1 anticorps

Épitope: C-Term

Specificité: PSG1 antibody was raised against the C terminal of PSG1

Purification: Purified

Immunogène: PSG1 antibody was raised using the C terminal of PSG1 corresponding to a region with amino acids YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSG1 Blocking Peptide, (ABIN936152), is also available for use as a blocking control in assays to test for specificity of this PSG1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSG1

Antigène: PSG1 (Pregnancy Specific beta-1-Glycoprotein 1 (PSG1))

Autre désignation: PSG1

Sujet: PSG1 plays an immunomodulatory roles during pregnancy.

Poids moléculaire: 47 kDa (MW of target protein)