MCM7 anticorps (N-Term)

N° du produit ABIN630182

Détail du produit anti-MCM7 anticorps

Antigène: MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCM7 est non-conjugé

Application: Western Blotting (WB)

Specificité: MCM7 antibody was raised against the N terminal of MCM7

Purification: Purified

Immunogène: MCM7 antibody was raised using the N terminal of MCM7 corresponding to a region with amino acids MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYV

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MCM7 Blocking Peptide, catalog no. 33R-5687, is also available for use as a blocking control in assays to test for specificity of this MCM7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCM7

Antigène: MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))

Autre désignation: MCM7 (MCM7 Produits)

Synonymes: anticorps CDC47, anticorps MCM2, anticorps P1.1-MCM3, anticorps P1CDC47, anticorps P85MCM, anticorps PNAS146, anticorps MCM7, anticorps AI747533, anticorps Mcmd7, anticorps mCDC47, anticorps chunp6911, anticorps nyz175, anticorps sr:nyz175, anticorps cdc47, anticorps cdc47-2, anticorps mcm7, anticorps xmcm7, anticorps CG4978, anticorps DmMCM7, anticorps DmeMCM7, anticorps Dmel\\CG4978, anticorps McM7, anticorps Mcp-PCR1, anticorps PCR1, anticorps anon-EST:Liang-1.66, anticorps clone 1.66, anticorps minichromosome maintenance complex component 7, anticorps mini-chromosome maintenance complex protein 7, anticorps minichromosome maintenance complex component 2, anticorps minichromosome maintenance complex component 7 L homeolog, anticorps Minichromosome maintenance 7, anticorps minichromosome maintenance complex component 7 S homeolog, anticorps MCM complex subunit Mcm7, anticorps MCM7, anticorps CDC47, anticorps Mcm7, anticorps MCM2, anticorps mcm7, anticorps mcm7.L, anticorps mcm7.S

Sujet: MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA