MCM7 anticorps (Middle Region)

N° du produit ABIN630194

L’anticorps Lapin Polyclonal anti-MCM7 a été validé pour WB. Il convient pour détecter MCM7 dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour MCM7 anticorps (Middle Region) (ABIN630194)

Antigène: MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCM7 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MCM7 anticorps

Épitope: Middle Region

Specificité: MCM7 antibody was raised against the middle region of MCM7

Purification: Purified

Immunogène: MCM7 antibody was raised using the middle region of MCM7 corresponding to a region with amino acids GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MCM7 Blocking Peptide, (ABIN938684), is also available for use as a blocking control in assays to test for specificity of this MCM7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCM7

Antigène: MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))

Autre désignation: MCM7

Sujet: MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA