MCM7 anticorps (Middle Region)
-
- Antigène Voir toutes MCM7 Anticorps
- MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MCM7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MCM7 antibody was raised against the middle region of MCM7
- Purification
- Purified
- Immunogène
- MCM7 antibody was raised using the middle region of MCM7 corresponding to a region with amino acids GGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV
- Top Product
- Discover our top product MCM7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MCM7 Blocking Peptide, catalog no. 33R-3298, is also available for use as a blocking control in assays to test for specificity of this MCM7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MCM7 (Minichromosome Maintenance Complex Component 7 (MCM7))
- Autre désignation
- MCM7 (MCM7 Produits)
- Synonymes
- anticorps CDC47, anticorps MCM2, anticorps P1.1-MCM3, anticorps P1CDC47, anticorps P85MCM, anticorps PNAS146, anticorps MCM7, anticorps AI747533, anticorps Mcmd7, anticorps mCDC47, anticorps chunp6911, anticorps nyz175, anticorps sr:nyz175, anticorps cdc47, anticorps cdc47-2, anticorps mcm7, anticorps xmcm7, anticorps CG4978, anticorps DmMCM7, anticorps DmeMCM7, anticorps Dmel\\CG4978, anticorps McM7, anticorps Mcp-PCR1, anticorps PCR1, anticorps anon-EST:Liang-1.66, anticorps clone 1.66, anticorps minichromosome maintenance complex component 7, anticorps mini-chromosome maintenance complex protein 7, anticorps minichromosome maintenance complex component 2, anticorps minichromosome maintenance complex component 7 L homeolog, anticorps Minichromosome maintenance 7, anticorps minichromosome maintenance complex component 7 S homeolog, anticorps MCM complex subunit Mcm7, anticorps MCM7, anticorps CDC47, anticorps Mcm7, anticorps MCM2, anticorps mcm7, anticorps mcm7.L, anticorps mcm7.S
- Sujet
- MCM7 encodes a protein that is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.
- Poids moléculaire
- 42 kDa (MW of target protein)
- Pathways
- Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA
-