NOLC1 anticorps (C-Term)

N° du produit ABIN630195

Cet anticorps anti-NOLC1 est un anticorps Lapin Polyclonal détectant NOLC1 dans WB et IHC. Adapté pour Humain, Rat, Souris, Chien, Drosophila melanogaster et Arabidopsis.

Aperçu rapide pour NOLC1 anticorps (C-Term) (ABIN630195)

Antigène: NOLC1 (Nucleolar and Coiled-Body Phosphoprotein 1 (NOLC1))

Reactivité: Humain, Rat, Souris, Chien, Drosophila melanogaster, Arabidopsis

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NOLC1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-NOLC1 anticorps

Épitope: C-Term

Specificité: NOLC1 antibody was raised against the C terminal of NOLC1

Purification: Purified

Immunogène: NOLC1 antibody was raised using the C terminal of NOLC1 corresponding to a region with amino acids DNSFDAKRGAAGDWGERANQVLKFTKGKSFRHEKTKKKRGSYRGGSISVQ

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NOLC1 Blocking Peptide, (ABIN937475), is also available for use as a blocking control in assays to test for specificity of this NOLC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOLC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NOLC1

Antigène: NOLC1 (Nucleolar and Coiled-Body Phosphoprotein 1 (NOLC1))

Autre désignation: NOLC1

Sujet: Related to nucleologenesis, NOLC1 may play a role in the maintenance of the fundamental structure of the fibrillar center and dense fibrillar component in the nucleolus. It has intrinsic GTPase and ATPase activities. NOLC1 may play an important role in transcription catalyzed by RNA polymerase I.

Poids moléculaire: 73 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling