TPTE anticorps (C-Term)

N° du produit ABIN630201

Cet anticorps anti-TPTE est un anticorps Lapin Polyclonal détectant TPTE dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour TPTE anticorps (C-Term) (ABIN630201)

Antigène: TPTE (Transmembrane Phosphatase with Tensin Homology (TPTE))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPTE est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-TPTE anticorps

Épitope: C-Term

Specificité: TPTE antibody was raised against the C terminal of TPTE

Purification: Purified

Immunogène: TPTE antibody was raised using the C terminal of TPTE corresponding to a region with amino acids KILIDVFDGPPLYDDVKVQFFYSNLPTYYDNCSFYFWLHTSFIENNRLYL

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TPTE Blocking Peptide, (ABIN939824), is also available for use as a blocking control in assays to test for specificity of this TPTE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPTE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPTE

Antigène: TPTE (Transmembrane Phosphatase with Tensin Homology (TPTE))

Autre désignation: TPTE

Sujet: TPTE encodes a putative transmembrane tyrosine phosphatase that may be involved in signal transduction pathways of the endocrine or spermatogenetic function of the testis.

Poids moléculaire: 45 kDa (MW of target protein)

Pathways: Inositol Metabolic Process