GEM anticorps (C-Term)

N° du produit ABIN630220

Cet anticorps Lapin Polyclonal détecte spécifiquement GEM dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour GEM anticorps (C-Term) (ABIN630220)

Antigène: GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GEM est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-GEM anticorps

Épitope: C-Term

Specificité: GEM antibody was raised against the C terminal of GEM

Purification: Purified

Immunogène: GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GEM Blocking Peptide, (ABIN938459), is also available for use as a blocking control in assays to test for specificity of this GEM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GEM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GEM

Antigène: GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))

Autre désignation: GEM

Sujet: GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.

Poids moléculaire: 33 kDa (MW of target protein)